PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_56943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 363aa    MW: 40826.6 Da    PI: 6.682
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_56943.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.21.1e-51331591128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdee++++y  +kv ++ + +  +i+ v+++k+ePw+Lp+k+k +e+ewyf+s++d+ky+tg r+nrat+ gyWkatgkdke+++   
  MLOC_56943.1  33 LPPGFRFHPTDEEIIKFYVVPKVLDEAFVA-AAIEVVNLNKYEPWELPEKAKMGENEWYFYSRKDRKYPTGIRTNRATDVGYWKATGKDKEIFDPPL 128
                   79*************************998.78***************99999******************************************** PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +l+g+kktLvfykgrap+gekt+Wvmheyr+
  MLOC_56943.1 129 TLIGMKKTLVFYKGRAPRGEKTNWVMHEYRI 159
                   *****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-5920193IPR003441NAC domain
PROSITE profilePS5100556.25433193IPR003441NAC domain
PfamPF023651.9E-2634159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MVASNISITL ESIAEKASTM TDHLQVQQQA LELPPGFRFH PTDEEIIKFY VVPKVLDEAF  60
VAAAIEVVNL NKYEPWELPE KAKMGENEWY FYSRKDRKYP TGIRTNRATD VGYWKATGKD  120
KEIFDPPLTL IGMKKTLVFY KGRAPRGEKT NWVMHEYRIE SSKQLISNST TATSRISTTK  180
AASKWVVCRI FHKSTGLKKM VMPSYDMPMS MAAEHQHDFV GLDTLPPLMD YDMSSTLAHP  240
PLFPGATSYQ LHNVESGSSM MGSVALPMMN DHYYGNHHHQ VMAAPTLPLS LYQHQQQHQQ  300
MMIHMGADQG FMVGAEPGSG MSSMLSQEDA VAGLRNNYPG NTTATAVGET SWMNMGMDDI  360
WQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-492819910174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565350.16e-89PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLJ27e-72NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0X4D10.0M0X4D1_HORVD; Uncharacterized protein
STRINGMLOC_56943.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.22e-75NAC domain containing protein 38